(data stored in ACNUC7421 zone)

EMBL: CP001402.PE78

CP001402.PE78        Location/Qualifiers
FT   CDS             complement(68449..68856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0078"
FT                   /product="regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40714"
FT                   /db_xref="GOA:C4KJJ4"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ4"
FT                   /protein_id="ACR40714.1"
FT                   /translation="MEEELTGTARKIYLYLLRQKRPVGIRKIQKDLNLSSPSVVSYHIK
FT                   KLIEDGLVKEVDEGYIVTKVILEDYIRFRSALVPRSIFLTSFLVSSLVILIYLIISHPF
FT                   SADIFSLVIVFIITIISVYDVTRKYKKLKSL"
     MEEELTGTAR KIYLYLLRQK RPVGIRKIQK DLNLSSPSVV SYHIKKLIED GLVKEVDEGY        60
     IVTKVILEDY IRFRSALVPR SIFLTSFLVS SLVILIYLII SHPFSADIFS LVIVFIITII       120
     SVYDVTRKYK KLKSL                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page