(data stored in ACNUC7421 zone)

EMBL: CP001402.PE79

CP001402.PE79        Location/Qualifiers
FT   CDS             69064..69603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40715"
FT                   /db_xref="GOA:C4KJJ5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ5"
FT                   /protein_id="ACR40715.1"
FT                   /translation="MNIVVNVKQYLMVIAGVLVSLAIASLVVYVSHMFITYTIKKPNIV
FT                   ERQSGYAPQMYELTVNARPPNGSYINSYFIYSPLQSSLVINKDPVFHVYPSIIDLNSFN
FT                   NSAIITIYYSAHDRVNIAVTQQIFNVSVINTTVINDEIVATQVKITFYNASPNTIYLIP
FT                   IWNQYNVTYYVLIYYE"
     MNIVVNVKQY LMVIAGVLVS LAIASLVVYV SHMFITYTIK KPNIVERQSG YAPQMYELTV        60
     NARPPNGSYI NSYFIYSPLQ SSLVINKDPV FHVYPSIIDL NSFNNSAIIT IYYSAHDRVN       120
     IAVTQQIFNV SVINTTVIND EIVATQVKIT FYNASPNTIY LIPIWNQYNV TYYVLIYYE        179
//

If you have problems or comments...

PBIL Back to PBIL home page