(data stored in ACNUC7421 zone)

EMBL: CP001402.PE8

CP001402.PE8         Location/Qualifiers
FT   CDS             complement(4901..5728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40644"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC4"
FT                   /protein_id="ACR40644.1"
FT                   /translation="MKFARSYKMLILPKRLIDILSESMSLKEAYTQYKNRNLNYALKLL
FT                   DELITQDPDLKEAYSLKGKILFELGKLQEAYENFQKAEDKIGMAKVLIAQGLYRDALTY
FT                   LDDNSKESSKLRGLIYLKLENYEKALDETKTIEDEDPLIYKIRGISELKLGRYNDAIID
FT                   LSFAIEKYPTDAELYFYRALAQRGLGNYKEAESDLEMAINLNPYYAEVYFSLGELKESR
FT                   GLLQEAVDMYSKTININPLYRSAYVRRAKSLMKLGREDEAYADIRKANELDSS"
     MKFARSYKML ILPKRLIDIL SESMSLKEAY TQYKNRNLNY ALKLLDELIT QDPDLKEAYS        60
     LKGKILFELG KLQEAYENFQ KAEDKIGMAK VLIAQGLYRD ALTYLDDNSK ESSKLRGLIY       120
     LKLENYEKAL DETKTIEDED PLIYKIRGIS ELKLGRYNDA IIDLSFAIEK YPTDAELYFY       180
     RALAQRGLGN YKEAESDLEM AINLNPYYAE VYFSLGELKE SRGLLQEAVD MYSKTININP       240
     LYRSAYVRRA KSLMKLGRED EAYADIRKAN ELDSS                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page