(data stored in ACNUC7421 zone)

EMBL: CP001402.PE81

CP001402.PE81        Location/Qualifiers
FT   CDS             70253..70558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40717"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ7"
FT                   /protein_id="ACR40717.1"
FT                   /translation="MSTTKKFYELQDLILAKMSLEKVKLHIEERKDRTIFKWVRKELTG
FT                   FFRKFSNVERFRDLVNSINKGLEEENYELILENVKRSLAIISDEIEKYYQDLQKMQ"
     MSTTKKFYEL QDLILAKMSL EKVKLHIEER KDRTIFKWVR KELTGFFRKF SNVERFRDLV        60
     NSINKGLEEE NYELILENVK RSLAIISDEI EKYYQDLQKM Q                           101
//

If you have problems or comments...

PBIL Back to PBIL home page