(data stored in ACNUC7421 zone)

EMBL: CP001402.PE85

CP001402.PE85        Location/Qualifiers
FT   CDS             73011..73661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0085"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40721"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK1"
FT                   /protein_id="ACR40721.1"
FT                   /translation="MDTLDLIAEEVRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPG
FT                   ENEDIEGKPFVGAAGKLLTRLINEVLGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSP
FT                   YLHRQIELIRPRIIITLGRHSTSYLFQIMNIKMESIGKVRGKFYTWNEYGYKILVFPTY
FT                   HPAAALYNPPIRKILEEDFRKVKEALSSKPITLDNFLYGSGNKGEKGNSDSSK"
     MDTLDLIAEE VRKCQKCRLW KYRKNAVPGE GNNKAEIMFI GEAPGENEDI EGKPFVGAAG        60
     KLLTRLINEV LGLSRDDVFI TNLVKCRPPN NRDPEEDEII ACSPYLHRQI ELIRPRIIIT       120
     LGRHSTSYLF QIMNIKMESI GKVRGKFYTW NEYGYKILVF PTYHPAAALY NPPIRKILEE       180
     DFRKVKEALS SKPITLDNFL YGSGNKGEKG NSDSSK                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page