(data stored in ACNUC7421 zone)

EMBL: CP001402.PE87

CP001402.PE87        Location/Qualifiers
FT   CDS             74508..75995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK3"
FT                   /protein_id="ACR40723.1"
FT                   /translation="MRITEFYVSNFRSLSEVNLKDLGGFNVVVGYNGYGKTNLLSSIFL
FT                   FIKNLSAGIEKRSVEDRNQEFILLWQGYDVSKPIMIGGKVEFSPEEANKIVGKNQKITL
FT                   EIVNKMRYNNKFVEWNLDTLYINGSPPGEDDLKVAKKLAEYASQAIEYVPIFDQAYFDE
FT                   TLRRMTDMNKSPINLRKYWYDFVNLVAATIPEVKGMEFWDGRRLVLNVYNLPIYIDLAA
FT                   SGFQRVILMLFIIWLSGNKILLIEEPEVNMHPTLQAKIMKLIKNWTDNNILQSFLTTHS
FT                   PYIVEMSADSYVVMRRVNGNSTAITVKPTADLRGTISLLNASLSSILFSRIIILTSELA
FT                   EPSVIVNWLKRLNINVEDNGISVYKVSSDLELQHWLKLKNMLNLDVIFLGLCDKLDITL
FT                   KDYCVPLSREVENFYSKQALLEVLRRLGIYPDEKEIRDLGKEENLRWIINVLRKRGIEY
FT                   EKLRMSIGELITNADTIEIPKEIEILANKIKSLQATL"
     MRITEFYVSN FRSLSEVNLK DLGGFNVVVG YNGYGKTNLL SSIFLFIKNL SAGIEKRSVE        60
     DRNQEFILLW QGYDVSKPIM IGGKVEFSPE EANKIVGKNQ KITLEIVNKM RYNNKFVEWN       120
     LDTLYINGSP PGEDDLKVAK KLAEYASQAI EYVPIFDQAY FDETLRRMTD MNKSPINLRK       180
     YWYDFVNLVA ATIPEVKGME FWDGRRLVLN VYNLPIYIDL AASGFQRVIL MLFIIWLSGN       240
     KILLIEEPEV NMHPTLQAKI MKLIKNWTDN NILQSFLTTH SPYIVEMSAD SYVVMRRVNG       300
     NSTAITVKPT ADLRGTISLL NASLSSILFS RIIILTSELA EPSVIVNWLK RLNINVEDNG       360
     ISVYKVSSDL ELQHWLKLKN MLNLDVIFLG LCDKLDITLK DYCVPLSREV ENFYSKQALL       420
     EVLRRLGIYP DEKEIRDLGK EENLRWIINV LRKRGIEYEK LRMSIGELIT NADTIEIPKE       480
     IEILANKIKS LQATL                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page