(data stored in ACNUC7421 zone)

EMBL: CP001402.PE88

CP001402.PE88        Location/Qualifiers
FT   CDS             75999..76244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0088"
FT                   /product="Protein of unknown function DUF131"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40724"
FT                   /db_xref="GOA:C4KJK4"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK4"
FT                   /protein_id="ACR40724.1"
FT                   /translation="MDLSILFDIGILLIFIGIILLFVGMIREASNSSDRDQKTHVGGVI
FT                   FIGPIPIVFGSSKGIAKWMLIVAVILVILMVIFYIL"
     MDLSILFDIG ILLIFIGIIL LFVGMIREAS NSSDRDQKTH VGGVIFIGPI PIVFGSSKGI        60
     AKWMLIVAVI LVILMVIFYI L                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page