(data stored in ACNUC7421 zone)

EMBL: CP001402.PE89

CP001402.PE89        Location/Qualifiers
FT   CDS             complement(76266..77549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40725"
FT                   /db_xref="GOA:C4KJK5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK5"
FT                   /protein_id="ACR40725.1"
FT                   /translation="MRSTTVAILALITVWGILGSLVISQANTTIINSITIPTSMTYTVK
FT                   LINSTTVANKTITHVYNYTLTYQVTKFVQNVIYVNISGNFTNGSLKLGNDVYIKKGEYE
FT                   VNLLYQPLSIYYPFIEPSLIYNTSYGIITPNETMALVYKGKTFSITNGVNYTSYNYSVN
FT                   INNQQISVNILGNGIVSKLENRSLELILHSFSNLSTIPLNSIANSQYTSFLNRSYLYAV
FT                   YNYSALSNSLIPEGYLQISYPIVLGNDTITAQITQIQMRAGQQLALPASLLGDSVNFVL
FT                   YINQPQNIPTSFTLNVGAKNITWNNNVFTLVGESKVSTPIGNFIAYQYVRNISQNQVQQ
FT                   VLYFTPNGTLIKEEVVEMINSTTQIPSFSLSFVGNNYISPYETYPNVFNYTNTSLPFKV
FT                   INPNLSFTISIVITIIIVAVLVILRKKD"
     MRSTTVAILA LITVWGILGS LVISQANTTI INSITIPTSM TYTVKLINST TVANKTITHV        60
     YNYTLTYQVT KFVQNVIYVN ISGNFTNGSL KLGNDVYIKK GEYEVNLLYQ PLSIYYPFIE       120
     PSLIYNTSYG IITPNETMAL VYKGKTFSIT NGVNYTSYNY SVNINNQQIS VNILGNGIVS       180
     KLENRSLELI LHSFSNLSTI PLNSIANSQY TSFLNRSYLY AVYNYSALSN SLIPEGYLQI       240
     SYPIVLGNDT ITAQITQIQM RAGQQLALPA SLLGDSVNFV LYINQPQNIP TSFTLNVGAK       300
     NITWNNNVFT LVGESKVSTP IGNFIAYQYV RNISQNQVQQ VLYFTPNGTL IKEEVVEMIN       360
     STTQIPSFSL SFVGNNYISP YETYPNVFNY TNTSLPFKVI NPNLSFTISI VITIIIVAVL       420
     VILRKKD                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page