(data stored in ACNUC7421 zone)

EMBL: CP001402.PE9

CP001402.PE9         Location/Qualifiers
FT   CDS             complement(6219..7049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0009"
FT                   /product="AIG2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40645"
FT                   /db_xref="GOA:C4KJC5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC5"
FT                   /protein_id="ACR40645.1"
FT                   /translation="MYLFVYGSLRYGFELNHLVAKSRFIGLGYIEGYEMYDLGNYPGII
FT                   KGDGIVWGEVYEIDENLIKLLDEVEDYKGSPDDLYVREKTRVYFDQKRKYYLDNVYFYR
FT                   YNREIANDMEKIEDGDYSAWSGMPIIVNYFAYAENTNEKILRQRGVDIMLSEIPAYMKG
FT                   YRLIFNVPCKYGYCANLLEDENGIICGYLQKVFLHTLNSLDKAEQHLIKYIREVVKVYD
FT                   RNGKEYFAYAYVSSHKDDREKPSEEYLKMIREGLMRGWGNECVSTGLYDEAGIS"
     MYLFVYGSLR YGFELNHLVA KSRFIGLGYI EGYEMYDLGN YPGIIKGDGI VWGEVYEIDE        60
     NLIKLLDEVE DYKGSPDDLY VREKTRVYFD QKRKYYLDNV YFYRYNREIA NDMEKIEDGD       120
     YSAWSGMPII VNYFAYAENT NEKILRQRGV DIMLSEIPAY MKGYRLIFNV PCKYGYCANL       180
     LEDENGIICG YLQKVFLHTL NSLDKAEQHL IKYIREVVKV YDRNGKEYFA YAYVSSHKDD       240
     REKPSEEYLK MIREGLMRGW GNECVSTGLY DEAGIS                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page