(data stored in ACNUC7421 zone)

EMBL: CP001402.PE93

CP001402.PE93        Location/Qualifiers
FT   CDS             complement(80311..80748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK9"
FT                   /protein_id="ACR40729.1"
FT                   /translation="MKAVERLDNTMAELNKINESELGINELDLLRFLKNQLSKSKSLFE
FT                   SFSKSIDEKRWDDVLSYTFQISQRVNSIFGYLVQPAVFSMISRSKLSENIENIIDSLAF
FT                   SVSEMIIVLKQNNKSLGIDTITVNMSSNPPSMSISVVIKGG"
     MKAVERLDNT MAELNKINES ELGINELDLL RFLKNQLSKS KSLFESFSKS IDEKRWDDVL        60
     SYTFQISQRV NSIFGYLVQP AVFSMISRSK LSENIENIID SLAFSVSEMI IVLKQNNKSL       120
     GIDTITVNMS SNPPSMSISV VIKGG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page