(data stored in ACNUC7421 zone)

EMBL: CP001402.PE95

CP001402.PE95        Location/Qualifiers
FT   CDS             82201..83319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40731"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL1"
FT                   /protein_id="ACR40731.1"
FT                   /translation="MAKKLELPVLLKDIISNYIVNYLTSSSSISLGAENLVGENDNSGI
FT                   LVSPLNEFIKVVSAESNQSLIYSLDGSSRSFISSKGIISVASVVVSSTISPIFGVYPPI
FT                   SGFPELDLRKPFLALASSAHQSPLLPFFYSSEYVTTLSLDGSFFTSVNSPEEIETEIRT
FT                   ILETESLKKIPNDGSVILDGPLIPPLIFLRSKVRDDVLNLRLEAIRGRNVIGIVKRLDK
FT                   SRLLISSLYKLSSKFMEKFRIDPRRYFSDESFILDLIKANLSPPYSPISLGPILRNIDN
FT                   TPVYVNYLIYPLHPYVYKFAILRVESLSNDSRAIDQLSSLKFTKDGIPFVLAIADRTAK
FT                   EITNAILKIVMTSLESMGLQASFYSKLEQVRI"
     MAKKLELPVL LKDIISNYIV NYLTSSSSIS LGAENLVGEN DNSGILVSPL NEFIKVVSAE        60
     SNQSLIYSLD GSSRSFISSK GIISVASVVV SSTISPIFGV YPPISGFPEL DLRKPFLALA       120
     SSAHQSPLLP FFYSSEYVTT LSLDGSFFTS VNSPEEIETE IRTILETESL KKIPNDGSVI       180
     LDGPLIPPLI FLRSKVRDDV LNLRLEAIRG RNVIGIVKRL DKSRLLISSL YKLSSKFMEK       240
     FRIDPRRYFS DESFILDLIK ANLSPPYSPI SLGPILRNID NTPVYVNYLI YPLHPYVYKF       300
     AILRVESLSN DSRAIDQLSS LKFTKDGIPF VLAIADRTAK EITNAILKIV MTSLESMGLQ       360
     ASFYSKLEQV RI                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page