(data stored in ACNUC7421 zone)

EMBL: CP001402.PE96

CP001402.PE96        Location/Qualifiers
FT   CDS             83316..85145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0096"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40732"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL2"
FT                   /protein_id="ACR40732.1"
FT                   /translation="MSSDVPLYNDIKDKISKARALAITLGDFIGKVSRYVPSRVDEENN
FT                   VVNVTIDPNTYYKYPFLGKIGIFLGAIDIKTLYFILLRVIGYERNDASSLFIGDSNVLN
FT                   NIGLSDDEPGSLITNVTLKCEMLTKVDFLSSSEPDAADIILEPQSPVIIPKPEVIERSL
FT                   GTTRGLLRLGFLDVAYSKVRVSASLDDLNFHMLILGTTGAGKTSFIKDLIAGLNVANEE
FT                   GSKIFILDATGDYYHIFLPPDRSDKVVMRGVEEFNQLYSAIVKGINLDIIYPVSKSWVK
FT                   KYLGGAKSAGSIAKVYFDMFVKPILNHLNNKGISIYASIINNKIIISNAEWSSQVTIYP
FT                   FYFRFKDVKTILHRLNPYFTEQASHFIKIMIRKKGKDIGKLEDLIDLFNENSLEGVEIH
FT                   RSTRENIVRGLYLLKETQLFDVGVERFPLSKILKESSSSTLVFDLYNSELDDFSQKILT
FT                   YYFLDRLFEFRERQMRSGNVKGRNVIIIDEAHRFFPSSKGGEEDTNYIRRVAGKIATMM
FT                   RLGRRRKIGFVFATHNPNDLSDIIIQLANTKIIFRIKSEVAETLGLSKTEAKILNWERN
FT                   GVAYLLTPWLREGKIKIKTPVPPPLGHYDLSKT"
     MSSDVPLYND IKDKISKARA LAITLGDFIG KVSRYVPSRV DEENNVVNVT IDPNTYYKYP        60
     FLGKIGIFLG AIDIKTLYFI LLRVIGYERN DASSLFIGDS NVLNNIGLSD DEPGSLITNV       120
     TLKCEMLTKV DFLSSSEPDA ADIILEPQSP VIIPKPEVIE RSLGTTRGLL RLGFLDVAYS       180
     KVRVSASLDD LNFHMLILGT TGAGKTSFIK DLIAGLNVAN EEGSKIFILD ATGDYYHIFL       240
     PPDRSDKVVM RGVEEFNQLY SAIVKGINLD IIYPVSKSWV KKYLGGAKSA GSIAKVYFDM       300
     FVKPILNHLN NKGISIYASI INNKIIISNA EWSSQVTIYP FYFRFKDVKT ILHRLNPYFT       360
     EQASHFIKIM IRKKGKDIGK LEDLIDLFNE NSLEGVEIHR STRENIVRGL YLLKETQLFD       420
     VGVERFPLSK ILKESSSSTL VFDLYNSELD DFSQKILTYY FLDRLFEFRE RQMRSGNVKG       480
     RNVIIIDEAH RFFPSSKGGE EDTNYIRRVA GKIATMMRLG RRRKIGFVFA THNPNDLSDI       540
     IIQLANTKII FRIKSEVAET LGLSKTEAKI LNWERNGVAY LLTPWLREGK IKIKTPVPPP       600
     LGHYDLSKT                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page