(data stored in ACNUC7421 zone)

EMBL: CP001402.PE97

CP001402.PE97        Location/Qualifiers
FT   CDS             85170..85559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40733"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL3"
FT                   /protein_id="ACR40733.1"
FT                   /translation="MESNLENVINTLKRKKDKEVVIEFLKTVRKYLPPSDDFSITLWKS
FT                   GIYEYILDRNGVAIMRIAEDEYLPYMSAYEKRMDYSQLPDNLVNNLDWKGVLRQLRDIA
FT                   LEYAKRDKNFDKIADMVNHVILENL"
     MESNLENVIN TLKRKKDKEV VIEFLKTVRK YLPPSDDFSI TLWKSGIYEY ILDRNGVAIM        60
     RIAEDEYLPY MSAYEKRMDY SQLPDNLVNN LDWKGVLRQL RDIALEYAKR DKNFDKIADM       120
     VNHVILENL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page