(data stored in ACNUC7421 zone)

EMBL: CP001402.PE99

CP001402.PE99        Location/Qualifiers
FT   CDS             complement(86454..87542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40735"
FT                   /db_xref="GOA:C4KJL5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL5"
FT                   /protein_id="ACR40735.1"
FT                   /translation="MGQYFIITSFTMIGLLFPVEFYSETKSLILLGVITGIYNALNALG
FT                   SYIWGYLIDKTRLRKEYAVILSLFGVVIGLIYHYNKLIAYELSGFVSALDGPIYSAILL
FT                   ETTPQEKLVLGNTRLSQISLAGNVTGSLLSAFYHNDYLILIFFSVSLIFNVIHIPKYDG
FT                   GINYDVADRNKLLRILLIPIISYFWFNMAAEIFYTLFVPLNYLMLNPSYVIFLSYTFLY
FT                   LIEEVIYSKGISMVKGREEYFMLLVTFARSLIVLSLVYIILMGLKIYEGTMLLFLVFGP
FT                   LFPVYNISFFSLLIKGLKRNKATIIGIFNVSEDIANVVGGFLSGSTNNIVSGYQISFYS
FT                   FALSLFLLYIYLRKPLRVSASS"
     MGQYFIITSF TMIGLLFPVE FYSETKSLIL LGVITGIYNA LNALGSYIWG YLIDKTRLRK        60
     EYAVILSLFG VVIGLIYHYN KLIAYELSGF VSALDGPIYS AILLETTPQE KLVLGNTRLS       120
     QISLAGNVTG SLLSAFYHND YLILIFFSVS LIFNVIHIPK YDGGINYDVA DRNKLLRILL       180
     IPIISYFWFN MAAEIFYTLF VPLNYLMLNP SYVIFLSYTF LYLIEEVIYS KGISMVKGRE       240
     EYFMLLVTFA RSLIVLSLVY IILMGLKIYE GTMLLFLVFG PLFPVYNISF FSLLIKGLKR       300
     NKATIIGIFN VSEDIANVVG GFLSGSTNNI VSGYQISFYS FALSLFLLYI YLRKPLRVSA       360
     SS                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page