(data stored in ACNUC7421 zone)

EMBL: CP001509.A

CP001509.A           Location/Qualifiers
FT   CDS             769185..771110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="A"
FT                   /locus_tag="ECD_10036"
FT                   /product="DNA packaging protein"
FT                   /note="similar to lambdap02"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42618"
FT                   /protein_id="ACT42618.1"
FT                   /translation="MNISNSQVNRLRHFVRAGLRSLFRPEPQTAVEWADANYYLPKESA
FT                   YQEGRWETLPFQRAIMNAMGSDYIREVNVVKSARVGYSKMLLGVYAYFIEHKQRNTLIW
FT                   LPTDGDAENFMKTHVEPTIRDIPSLLALAPWYGKKHRDNTLTMKRFTNGRGFWCLGGKA
FT                   AKNYREKSVDVAGYDELAAFDDDIEQEGSPTFLGDKRIEGSVWPKSIRGSTPKVRGTCQ
FT                   IERAASESPHFMRFHVACPHCGEEQYLKFGDKETPFGLKWTPDDPSSVFYLCEHNACVI
FT                   RQQELDFTDARYICEKTGIWTRDGILWFSSSGEEIEPPDSVTFHIWTAYSPFTTWVQIV
FT                   KDWMKTKGDTGKRKTFVNTTLGETWEAKIGERPDAEVMAERKEHYSAPVPDRVAYLTAG
FT                   IDSQLDRYEMRVWGWGPGEESWLIDRQIIMGRHDDEQTLLRVDEAINKTYTRRNGAEMS
FT                   ISRICWDTGGIDPTIVYERSKKHGLFRVIPIKGASVYGKPVASMPRKRNKNGVYLTEIG
FT                   TDTAKEQIYNRFTLTPEGDEPLPGAVHFPNNPDIFDLTEAQQLTAEEQVEKWVDGRKKI
FT                   LWDSKKRRNEALDCFVYALAALRISISRWQLDLSALLASLQEEDGAATNKKTLADYARA
FT                   LSGEDE"
     MNISNSQVNR LRHFVRAGLR SLFRPEPQTA VEWADANYYL PKESAYQEGR WETLPFQRAI        60
     MNAMGSDYIR EVNVVKSARV GYSKMLLGVY AYFIEHKQRN TLIWLPTDGD AENFMKTHVE       120
     PTIRDIPSLL ALAPWYGKKH RDNTLTMKRF TNGRGFWCLG GKAAKNYREK SVDVAGYDEL       180
     AAFDDDIEQE GSPTFLGDKR IEGSVWPKSI RGSTPKVRGT CQIERAASES PHFMRFHVAC       240
     PHCGEEQYLK FGDKETPFGL KWTPDDPSSV FYLCEHNACV IRQQELDFTD ARYICEKTGI       300
     WTRDGILWFS SSGEEIEPPD SVTFHIWTAY SPFTTWVQIV KDWMKTKGDT GKRKTFVNTT       360
     LGETWEAKIG ERPDAEVMAE RKEHYSAPVP DRVAYLTAGI DSQLDRYEMR VWGWGPGEES       420
     WLIDRQIIMG RHDDEQTLLR VDEAINKTYT RRNGAEMSIS RICWDTGGID PTIVYERSKK       480
     HGLFRVIPIK GASVYGKPVA SMPRKRNKNG VYLTEIGTDT AKEQIYNRFT LTPEGDEPLP       540
     GAVHFPNNPD IFDLTEAQQL TAEEQVEKWV DGRKKILWDS KKRRNEALDC FVYALAALRI       600
     SISRWQLDLS ALLASLQEED GAATNKKTLA DYARALSGED E                           641
//

If you have problems or comments...

PBIL Back to PBIL home page