(data stored in ACNUC7421 zone)

EMBL: CP001509.ABRB

CP001509.ABRB        Location/Qualifiers
FT   CDS             complement(705287..706333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="ECD_00675"
FT                   /product="regulator of aidB expression; inner membrane
FT                   protein"
FT                   /note="similar to b0715"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42550"
FT                   /protein_id="ACT42550.1"
FT                   /translation="MPVLQWGMLCVLSLLLSIGFLAVHLPAALLLGPMIAGIIFSMRGI
FT                   TLQLPRSAFLAAQAILGCMIAQNLTGSILTTLAANWPIVLAILLVTLLSSAIVGWLLVR
FT                   YSSLPGNTGAWGSSPGGAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLG
FT                   DNAEAVNQQIVWFPPVSINLLLTILLAVVAGTAGCMLRLPSGTMLIPMLAGAVLQSGQL
FT                   ITIELPEWLLAMAYMAIGWRIGLGFDKQILLRALRPLPQILLSIFALLAICAGMAWGLT
FT                   RFMHIDFMTAYLATSPGGLDTVAVIAAGSNADMALIMAMQTLRLFSILLTGPAIARFIS
FT                   TYAPKRSA"
     MPVLQWGMLC VLSLLLSIGF LAVHLPAALL LGPMIAGIIF SMRGITLQLP RSAFLAAQAI        60
     LGCMIAQNLT GSILTTLAAN WPIVLAILLV TLLSSAIVGW LLVRYSSLPG NTGAWGSSPG       120
     GAAAMVAMAQ DYGADIRLVA FMQYLRVLFV AGAAVLVTRM MLGDNAEAVN QQIVWFPPVS       180
     INLLLTILLA VVAGTAGCML RLPSGTMLIP MLAGAVLQSG QLITIELPEW LLAMAYMAIG       240
     WRIGLGFDKQ ILLRALRPLP QILLSIFALL AICAGMAWGL TRFMHIDFMT AYLATSPGGL       300
     DTVAVIAAGS NADMALIMAM QTLRLFSILL TGPAIARFIS TYAPKRSA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page