(data stored in ACNUC7421 zone)

EMBL: CP001509.ACPH

CP001509.ACPH        Location/Qualifiers
FT   CDS             complement(389739..390320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECD_00352"
FT                   /product="acyl carrier protein (ACP) phosphodiesterase; ACP
FT                   hydrolyase"
FT                   /note="split in REL606; similar to b0404"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42251"
FT                   /protein_id="ACT42251.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYDALETRFWQFYPRMMAQASRKAL"
     MNFLAHLHLA HLAESSLSGN LLADFVRGNP EESFPPDVVA GIHMHRRIDV LTDNLPEVRE        60
     AREWFRSETR RVAPITLDVM WDHFLSRHWS QLSPDFPLQE FVCYAREQVM TILPDSPPRF       120
     INLNNYLWSE QWLVRYRDMD FIQNVLNGMA SRRPRLDALR DSWYDLDAHY DALETRFWQF       180
     YPRMMAQASR KAL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page