(data stored in ACNUC7421 zone)

EMBL: CP001509.ADK

CP001509.ADK         Location/Qualifiers
FT   CDS             466221..466865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECD_00425"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="similar to b0474"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42324"
FT                   /protein_id="ACT42324.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
     MRIILLGAPG AGKGTQAQFI MEKYGIPQIS TGDMLRAAVK SGSELGKQAK DIMDAGKLVT        60
     DELVIALVKE RIAQEDCRNG FLLDGFPRTI PQADAMKEAG INVDYVLEFD VPDELIVDRI       120
     VGRRVHAPSG RVYHVKFNPP KVEGKDDVTG EELTTRKDDQ EETVRKRLVE YHQMTAPLIG       180
     YYSKEAEAGN TKYAKVDGTK PVAEVRADLE KILG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page