(data stored in ACNUC7421 zone)

EMBL: CP001509.AHPC

CP001509.AHPC        Location/Qualifiers
FT   CDS             598775..599338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="ECD_00574"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit"
FT                   /EC_number="1.11.1.15"
FT                   /note="similar to b0605"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42452"
FT                   /protein_id="ACT42452.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
     MSLINTKIKP FKNQAFKNGE FIEITEKDTE GRWSVFFFYP ADFTFVCPTE LGDVADHYEE        60
     LQKLGVDVYA VSTDTHFTHK AWHSSSETIA KIKYAMIGDP TGALTRNFDN MREDEGLADR       120
     ATFVVDPQGI IQAIEVTAEG IGRDASDLLR KIKAAQYVAS HPGEVCPAKW KEGEATLAPS       180
     LDLVGKI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page