(data stored in ACNUC7421 zone)

EMBL: CP001509.AHPF

CP001509.AHPF        Location/Qualifiers
FT   CDS             599583..601148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="ECD_00575"
FT                   /product="alkyl hydroperoxide reductase, F52a subunit,
FT                   FAD/NAD(P)-binding"
FT                   /EC_number="1.11.1.15"
FT                   /note="similar to b0606"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42453"
FT                   /protein_id="ACT42453.1"
FT                   /translation="MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAE
FT                   LSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKE
FT                   AQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEI
FT                   TDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGP
FT                   AGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYD
FT                   VDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTK
FT                   GVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDK
FT                   LRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL
FT                   EGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIR
FT                   TKTA"
     MLDTNMKTQL KAYLEKLTKP VELIATLDDS AKSAEIKELL AEIAELSDKV TFKEDNSLPV        60
     RKPSFLITNP GSNQGPRFAG SPLGHEFTSL VLALLWTGGH PSKEAQSLLE QIRHIDGDFE       120
     FETYYSLSCH NCPDVVQALN LMSVLNPRIK HTAIDGGTFQ NEITDRNVMG VPAVFVNGKE       180
     FGQGRMTLTE IVAKIDTGAE KRAAEELNKR DAYDVLIVGS GPAGAAAAIY SARKGIRTGL       240
     MGERFGGQIL DTVDIENYIS VPKTEGQKLA GALKVHVDEY DVDVIDSQSA SKLIPAAVEG       300
     GLHQIETASG AVLKARSIIV ATGAKWRNMN VPGEDQYRTK GVTYCPHCDG PLFKGKRVAV       360
     IGGGNSGVEA AIDLAGIVEH VTLLEFAPEM KADQVLQDKL RSLKNVDIIL NAQTTEVKGD       420
     GSKVVGLEYR DRVSGDIHNI ELAGIFVQIG LLPNTNWLEG AVERNRMGEI IIDAKCETNV       480
     KGVFAAGDCT TVPYKQIIIA TGEGAKASLS AFDYLIRTKT A                           521
//

If you have problems or comments...

PBIL Back to PBIL home page