(data stored in ACNUC7421 zone)

EMBL: CP001509.AMPE

CP001509.AMPE        Location/Qualifiers
FT   CDS             122086..122940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECD_00110"
FT                   /product="ampicillin resistance inner membrane protein;
FT                   putative signaling protein in beta-lactamase regulation"
FT                   /note="similar to b0111"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42011"
FT                   /protein_id="ACT42011.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
     MTLFTTLLVL IFERLFKLGE HWQLDHRLEA FFRRVKHFSL GRTLGMTIIA MGVTFLLLRA        60
     LQGVLFNVPT LLVWLLIGLL CIGAGKVRLH YHAYLTAASR NDSHARATMA GELTMIHGVP       120
     AGCDEREYLR ELQNALLWIN FRFYLAPLFW LIVGGTWGPV TLMGYAFLRA WQYWLARYQT       180
     PHHRLQSGID AVLHVLDWVP VRLAGVVYAL IGHGEKALPA WFASLGDFHT SQYQVLTRLA       240
     QFSLAREPHV DKVETPKAAV SMAKKTSFVV VVVIALLTIY GALV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page