(data stored in ACNUC7421 zone)

EMBL: CP001509.AMPH

CP001509.AMPH        Location/Qualifiers
FT   CDS             complement(359755..360912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ECD_00323"
FT                   /product="D-alanyl-D-alanine-carboxypeptidase/endopeptidase;
FT                   penicillin-binding protein; weak beta-lactamase"
FT                   /note="similar to b0376"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42222"
FT                   /protein_id="ACT42222.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYPRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
     MKRSLLFSAV LCAASLTSVH AAQPITEPEF ASDIVDRYAD HIFYGSGATG MALVVIDGNQ        60
     RVFRSYGETR PGNNVRPQLD SVVRIASLTK LMTSEMLVKL LDQGTVKLND PLSKYAPPGA       120
     RVPTYNGTPI TLVNLATHTS ALPREQPGGA AHRPVFVWPT REQRWKYLST AKLKAAPGSQ       180
     AAYSNLAFDL LADALANASG KPYTQLFEEQ ITRPLGMKDT TYTPSPDQCR RLMVAERGAS       240
     PCNNTLAAIG SGGVYSTPGD MMRWMQQYLS SDFYQRSNQA DRMQTLIYPR AQFTKVIGMD       300
     VPGKADALGL GWVYMAPKEG RPGIIQKTGG GGGFITYMAM IPQKNIGAFV VVTRSPLTRF       360
     KNMSDGINDL VTELSGNKPL VIPAS                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page