(data stored in ACNUC7421 zone)

EMBL: CP001509.APAG

CP001509.APAG        Location/Qualifiers
FT   CDS             complement(55425..55802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECD_00054"
FT                   /product="protein associated with Co2+ and Mg2+ efflux"
FT                   /note="similar to b0050"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41955"
FT                   /protein_id="ACT41955.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
     MINSPRVCIQ VQSVYIEAQS SPDNERYVFA YTVTIRNLGR APVQLLGRYW LITNGNGRET        60
     EVQGEGVVGV QPLIAPGEEY QYTSGAIIET PLGTMQGHYE MIDENGVPFS IDIPVFRLAV       120
     PTLIH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page