(data stored in ACNUC7421 zone)

EMBL: CP001509.AROL

CP001509.AROL        Location/Qualifiers
FT   CDS             371030..371554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ECD_00335"
FT                   /product="shikimate kinase II"
FT                   /EC_number="2.7.1.71"
FT                   /note="similar to b0388"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42234"
FT                   /protein_id="ACT42234.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
     MTQPLFLIGP RGCGKTTVGM ALADSLNRRF VDTDQWLQSQ LNMTVAEIVE REEWAGFRAR        60
     ETAALEAVTA PSTVIATGGG IILTEFNRHF MQNNGIVVYL CAPVSVLVNR LQAAPEEDLR       120
     PTLTGKPLSE EVQEVLEERD ALYREVAHII IDATNEPSQV ISEIRSALAQ TINC             174
//

If you have problems or comments...

PBIL Back to PBIL home page