(data stored in ACNUC7421 zone)

EMBL: CP001509.AROM

CP001509.AROM        Location/Qualifiers
FT   CDS             372053..372730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECD_00337"
FT                   /product="AroM family protein"
FT                   /note="similar to b0390"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42236"
FT                   /protein_id="ACT42236.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNRGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEEMLPVQAQKWQILQKSPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFHQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
     MSASLAILTI GIVPMQEVLP LLTEYIDEDN ISHHSLLGKL SREEVMAEYA PEAGEDTILT        60
     LLNDNQLAHV SRRKVERDLQ GVVEVLDNRG YDVIILMSTA NISSMTARNT IFLEPSRILP       120
     PLVSSIVEDH QVGVIVPVEE MLPVQAQKWQ ILQKSPVFSL GNPIHDSEQK IIDAGKELLA       180
     KGADVIMLDC LGFHQRHRDL LQKQLDVPVL LSNVLIARLA AELLV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page