(data stored in ACNUC7421 zone)

EMBL: CP001509.BTUF

CP001509.BTUF        Location/Qualifiers
FT   CDS             complement(180505..181305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ECD_00157"
FT                   /product="vitamin B12 ABC transporter periplasmic binding
FT                   protein"
FT                   /note="similar to b0158"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42058"
FT                   /protein_id="ACT42058.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKTQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
     MAKSLFRALV ALSFLAPLWL NAAPRVITLS PANTELAFAA GITPVGVSSY SDYPPQAQKI        60
     EQVSTWQGMN LERIVALKPD LVIAWRGGNA ERQVDQLASL GIKVMWVDAT SIEQIANALR       120
     QLAPWSPQPD KAEQAAQSLL DQYAQLKTQY ADKPKKRVFL QFGINPPFTS GKESIQNQVL       180
     EVCGGENIFK DSRVPWPQVS REQVLARSPQ AIVITGGPDQ IPKIKQYWGE QLKIPVIPLT       240
     SDWFERASPR IILAAQQLCN ALSQVD                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page