(data stored in ACNUC7421 zone)

EMBL: CP001509.C2

CP001509.C2          Location/Qualifiers
FT   CDS             complement(760101..760751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="C2"
FT                   /locus_tag="ECD_10021"
FT                   /product="Repressor protein C2"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42603"
FT                   /protein_id="ACT42603.1"
FT                   /translation="MNTQLMGERIRARRKELKIRQAALGKMVGVSNVAISQWERSETEP
FT                   NGENLLALAKALQCSPDYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPY
FT                   HRRAIDNWYDTTVDCSEDSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVA
FT                   KLEGENEATFKKLVIDAGRKFLKPLNPQYPMIEINGNCKIIGVVVDAKLANLP"
     MNTQLMGERI RARRKELKIR QAALGKMVGV SNVAISQWER SETEPNGENL LALAKALQCS        60
     PDYLLKGEDS LSNIAYHSRH DPRGSYPLIS WVSAGCWMEA VEPYHRRAID NWYDTTVDCS       120
     EDSFWLDVKG DSMTAPAGLS IPEGMIILVD PEVEPRNGKL VVAKLEGENE ATFKKLVIDA       180
     GRKFLKPLNP QYPMIEINGN CKIIGVVVDA KLANLP                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page