(data stored in ACNUC7421 zone)

EMBL: CP001509.CAIE

CP001509.CAIE        Location/Qualifiers
FT   CDS             complement(38976..39566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECD_00039"
FT                   /product="stimulator of CaiD and CaiB enzyme activities"
FT                   /note="similar to b0035"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41941"
FT                   /protein_id="ACT41941.1"
FT                   /translation="MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLIVQAGANIQDGCIMHGYCDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFSGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLV
FT                   GRYHASLHETQPLRQMEENRPRLQGTTDVTPKR"
     MSYYAFEGLI PVVHPTAFVH PSAVLIGDVI VGAGVYIGPL ASLRGDYGRL IVQAGANIQD        60
     GCIMHGYCDT DTIVGENGHI GHGAILHGCV IGRDALVGMN SVIMDGAVIG EESIVAAMSF       120
     VKAGFSGEKR QLLMGTPARA VRSVSDDELH WKRLNTKEYQ DLVGRYHASL HETQPLRQME       180
     ENRPRLQGTT DVTPKR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page