(data stored in ACNUC7421 zone)

EMBL: CP001509.CII

CP001509.CII         Location/Qualifiers
FT   CDS             761133..761432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cII"
FT                   /locus_tag="ECD_10023"
FT                   /product="antitermination protein"
FT                   /note="similar to lambdap59; distantly related"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42605"
FT                   /protein_id="ACT42605.1"
FT                   /translation="MAQASYSKPTQREIDRAETDLLINLSTLTQRGLAKMIGCHESKIS
FT                   RTDWRFIASVLCAFGMASDISPISRAFKYALDGLTKKKRPVCKTERSEQIQMEF"
     MAQASYSKPT QREIDRAETD LLINLSTLTQ RGLAKMIGCH ESKISRTDWR FIASVLCAFG        60
     MASDISPISR AFKYALDGLT KKKRPVCKTE RSEQIQMEF                               99
//

If you have problems or comments...

PBIL Back to PBIL home page