(data stored in ACNUC7421 zone)

EMBL: CP001509.CIII

CP001509.CIII        Location/Qualifiers
FT   CDS             complement(758420..758584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cIII"
FT                   /locus_tag="ECD_10016"
FT                   /product="antitermination protein"
FT                   /note="similar to lambdap86"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42598"
FT                   /protein_id="ACT42598.1"
FT                   /translation="MQYAIAGWPVAGCPSESLLERITRKLRDGWKRLIDILNQPGVPKN
FT                   GSNTYGYPD"
     MQYAIAGWPV AGCPSESLLE RITRKLRDGW KRLIDILNQP GVPKNGSNTY GYPD              54
//

If you have problems or comments...

PBIL Back to PBIL home page