(data stored in ACNUC7421 zone)

EMBL: CP001509.CRO

CP001509.CRO         Location/Qualifiers
FT   CDS             760832..761017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cro"
FT                   /locus_tag="ECD_10022"
FT                   /product="Regulatory protein cro (Antirepressor)"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42604"
FT                   /protein_id="ACT42604.1"
FT                   /translation="MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIV
FT                   TAGALKYQESAYRQAA"
     MYKKDVIDHF GTQRAVAKAL GISDAAVSQW KEVIPEKDAY RLEIVTAGAL KYQESAYRQA        60
     A                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page