(data stored in ACNUC7421 zone)

EMBL: CP001509.CUSF

CP001509.CUSF        Location/Qualifiers
FT   CDS             555813..556145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECD_00534"
FT                   /product="periplasmic copper-and silver-binding protein"
FT                   /note="similar to b0573"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42414"
FT                   /protein_id="ACT42414.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGEVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     MKKALQVAMF SLFTVIGFNA QANEHHHETM SEAQPQVISA TGEVKGIDLE SKKITIHHDP        60
     IAAVNWPEMT MRFTITPQTK MSEIKTGDKV AFNFVQQGNL SLLQDIKVSQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page