(data stored in ACNUC7421 zone)

EMBL: CP001509.CYDX

CP001509.CYDX        Location/Qualifiers
FT   CDS             732857..732970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydX"
FT                   /locus_tag="ECD_00694"
FT                   /product="cytochrome d (bd-I) ubiquinol oxidase subunit X"
FT                   /note="similar to b4515"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00694"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42569"
FT                   /protein_id="ACT42569.1"
FT                   /translation="MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI"
     MWYFAWILGT LLACSFGVIT ALALEHVESG KAGQEDI                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page