(data stored in ACNUC7421 zone)

EMBL: CP001509.CYOA

CP001509.CYOA        Location/Qualifiers
FT   CDS             complement(418345..419292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="ECD_00383"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="similar to b0432"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42282"
FT                   /protein_id="ACT42282.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAEFDQWVAKAKQSPNSMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
     MRLRKYNKSL GWLSLFAGTV LLSGCNSALL DPKGQIGLEQ RSLILTAFGL MLIVVIPAIL        60
     MAVGFAWKYR ASNKDAKYSP NWSHSNKVEA VVWTVPILII IFLAVLTWKT THALEPSKPL       120
     AHDEKPITIE VVSMDWKWFF IYPEQGIATV NEIAFPANTP VYFKVTSNSV MNSFFIPRLG       180
     SQIYAMAGMQ TRLHLIANEP GTYDGISASY SGPGFSGMKF KAIATPDRAE FDQWVAKAKQ       240
     SPNSMSDMAA FEKLAAPSEY NQVEYFSNVK PDLFADVINK FMAHGKSMDM TQPEGEHSAH       300
     EGMEGMDMSH AESAH                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page