(data stored in ACNUC7421 zone)

EMBL: CP001509.CYOC

CP001509.CYOC        Location/Qualifiers
FT   CDS             complement(415728..416342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECD_00381"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="similar to b0430"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42280"
FT                   /protein_id="ACT42280.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
     MATDTLTHAT AHAHEHGHHD AGGTKIFGFW IYLMSDCILF SILFATYAVL VNGTAGGPTG        60
     KDIFELPFVL VETFLLLFSS ITYGMAAIAM YKNNKSQVIS WLALTWLFGA GFIGMEIYEF       120
     HHLIVNGMGP DRSGFLSAFF ALVGTHGLHV TSGLIWMAVL MVQIARRGLT STNRTRIMCL       180
     SLFWHFLDVV WICVFTVVYL MGAM                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page