(data stored in ACNUC7421 zone)

EMBL: CP001509.D

CP001509.D           Location/Qualifiers
FT   CDS             774221..774553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="D"
FT                   /locus_tag="ECD_10040"
FT                   /product="head-DNA stabilization protein"
FT                   /note="similar to lambdap07"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42622"
FT                   /protein_id="ACT42622.1"
FT                   /translation="MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSR
FT                   KLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAG
FT                   TAISIV"
     MTSKETFTHY QPQGNSDPAH TATAPGGLSA KAPAMTPLML DTSSRKLVAW DGTTDGAAVG        60
     ILAVAADQTS TTLTFYKSGT FRYEDVLWPE AASDETKKRT AFAGTAISIV                  110
//

If you have problems or comments...

PBIL Back to PBIL home page