(data stored in ACNUC7421 zone)

EMBL: CP001509.DACA

CP001509.DACA        Location/Qualifiers
FT   CDS             complement(623114..624325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="ECD_00601"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /EC_number="3.4.16.4"
FT                   /note="similar to b0632"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42479"
FT                   /protein_id="ACT42479.1"
FT                   /translation="MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAES
FT                   KKLLTWGFRFFETVNPLKVGKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNSSELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
     MNTIFSARIM KRLALTTALC TAFISAAHAD DLNIKTMIPG VPQIDAESYI LIDYNSGKVL        60
     AEQNADVRRD PASLTKMMTS YVIGQAMKAG KFKETDLVTI GNDAWATGNP VFKGSSLMFL       120
     KPGMQVPVSQ LIRGINLQSG NDACVAMADF AAGSQDAFVG LMNSYVNALG LKNTHFQTVH       180
     GLDADGQYSS ARDMALIGQA LIRDVPNEYS IYKEKEFTFN GIRQLNRNGL LWDNSLNVDG       240
     IKTGHTDKAG YNLVASATEG QMRLISAVMG GRTFKGREAE SKKLLTWGFR FFETVNPLKV       300
     GKEFASEPVW FGDSDRASLG VDKDVYLTIP RGRMKDLKAS YVLNSSELHA PLQKNQVVGT       360
     INFQLDGKTI EQRPLVVLQE IPEGNFFGKI IDYIKLMFHH WFG                         403
//

If you have problems or comments...

PBIL Back to PBIL home page