(data stored in ACNUC7421 zone)

EMBL: CP001509.DJLA

CP001509.DJLA        Location/Qualifiers
FT   CDS             61560..62375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECD_00059"
FT                   /product="membrane-anchored DnaK co-chaperone, DNA-binding
FT                   protein"
FT                   /note="similar to b0055"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41960"
FT                   /protein_id="ACT41960.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWLQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
     MQYWGKIIGV AVALLMGGGF WGVVLGLLIG HMFDKARSRK MAWFANQRER QALFFATTFE        60
     VMGHLTKSKG RVTEADIHIA SQLMDRMNLH GASRTAAQNA FRVGKSDNYP LREKMRQFRS       120
     VCFGRFDLIR MFLEIQIQAA FADGSLHPNE RAVLYVIAEE LGISRAQFDQ FLRMMQGGAQ       180
     FGGGYQQQTG GGNWLQAQRG PTLEDACNVL GVKPTDDATT IKRAYRKLMS EHHPDKLVAK       240
     GLPPEMMEMA KQKAQEIQQA YELIKQQKGF K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page