(data stored in ACNUC7421 zone)

EMBL: CP001509.DJLC

CP001509.DJLC        Location/Qualifiers
FT   CDS             638089..639228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlC"
FT                   /locus_tag="ECD_00615"
FT                   /product="J domain-containing HscC co-chaperone; Hsc56"
FT                   /note="similar to b0649"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42492"
FT                   /protein_id="ACT42492.1"
FT                   /translation="MEDVDQLRWPLCAIAIEARYLSLNCASLLAERLNWHSFNDSEGMD
FT                   EEEREAFLEAIQAGDCFDFLSLLEYPIALQNQTVEYYFALERCCRYHPDYVTAFLAMEG
FT                   PWFIPDDAKLHRKLLRWYSSVQTGMAELIPVAQQWQMEEPESEDARYYLCAQRLYCGEG
FT                   ESLLADLCAYWESYPSTQADNLLLQWSKRHCPDYFALLVMVIEARSMVDAQGKPLKYVP
FT                   SESARTRLLWAEILHSGKLSPLGQSFIESLFFKRKAWAWWKSRVGSETEQDSPLLDLYR
FT                   VAEQVVLEAFPKQEMLARLNTRLEGGDAHPLEAIITRMLLTKVKLEPEDEDVDEPTPEN
FT                   HEEKNDEGEKPQSITSIIKISLTVLVIGYALGKIAMLFS"
     MEDVDQLRWP LCAIAIEARY LSLNCASLLA ERLNWHSFND SEGMDEEERE AFLEAIQAGD        60
     CFDFLSLLEY PIALQNQTVE YYFALERCCR YHPDYVTAFL AMEGPWFIPD DAKLHRKLLR       120
     WYSSVQTGMA ELIPVAQQWQ MEEPESEDAR YYLCAQRLYC GEGESLLADL CAYWESYPST       180
     QADNLLLQWS KRHCPDYFAL LVMVIEARSM VDAQGKPLKY VPSESARTRL LWAEILHSGK       240
     LSPLGQSFIE SLFFKRKAWA WWKSRVGSET EQDSPLLDLY RVAEQVVLEA FPKQEMLARL       300
     NTRLEGGDAH PLEAIITRML LTKVKLEPED EDVDEPTPEN HEEKNDEGEK PQSITSIIKI       360
     SLTVLVIGYA LGKIAMLFS                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page