(data stored in ACNUC7421 zone)

EMBL: CP001509.DKSA

CP001509.DKSA        Location/Qualifiers
FT   CDS             complement(163001..163456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECD_00144"
FT                   /product="transcriptional regulator of rRNA transcription;
FT                   DnaK suppressor protein"
FT                   /note="similar to b0145"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42045"
FT                   /protein_id="ACT42045.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     MQEGQNRKTS SLSILAIAGV EPYQEKPGEE YMNEAQLAHF RRILEAWRNQ LRDEVDRTVT        60
     HMQDEAANFP DPVDRAAQEE EFSLELRNRD RERKLIKKIE KTLKKVEDED FGYCESCGVE       120
     IGIRRLEARP TADLCIDCKT LAEIREKQMA G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page