(data stored in ACNUC7421 zone)

EMBL: CP001509.DNAQ

CP001509.DNAQ        Location/Qualifiers
FT   CDS             238994..239725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECD_00208"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to b0215"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42109"
FT                   /protein_id="ACT42109.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDDEL
FT                   AAHEARLDLVQKKGGSCLWRA"
     MSTAITRQIV LDTETTGMNQ IGAHYEGHKI IEIGAVEVVN RRLTGNNFHV YLKPDRLVDP        60
     EAFGVHGIAD EFLLDKPTFA EVADEFMDYI RGAELVIHNA AFDIGFMDYE FSLLKRDIPK       120
     TNTFCKVTDS LAVARKMFPG KRNSLDALCA RYEIDNSKRT LHGALLDAQI LAEVYLAMTG       180
     GQTSMAFAME GETQQQQGEA TIQRIVRQAS KLRVVFATDD ELAAHEARLD LVQKKGGSCL       240
     WRA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page