(data stored in ACNUC7421 zone)

EMBL: CP001509.DSBG

CP001509.DSBG        Location/Qualifiers
FT   CDS             complement(597642..598403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECD_00573"
FT                   /product="thiol:disulfide interchange protein, periplasmic"
FT                   /EC_number="5.3.4.1"
FT                   /note="similar to b0604"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42451"
FT                   /protein_id="ACT42451.1"
FT                   /translation="MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQS
FT                   HWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATA
FT                   AAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYY
FT                   MSKENTLQQAVGLPDQKTLNIIMGKVMLPTY"
     MLKKILLLAL LPAIAFAEEL PAPVKAIEKQ GITIIKTFDA PGGMKGYLGK YQDMGVTIYL        60
     TPDGKHAISG YMYNEKGENL SNTLIEKEIY APAGREMWQR MEQSHWLLDG KKDAPVIVYV       120
     FADPFCPYCK QFWQQARPWV DSGKVQLRTL LVGVIKPESP ATAAAILASK DPAKTWQQYE       180
     ASGGKLKLNV PANVSTEQMK VLSDNEKLMD DLGANVTPAI YYMSKENTLQ QAVGLPDQKT       240
     LNIIMGKVML PTY                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page