(data stored in ACNUC7421 zone)

EMBL: CP001509.EA10

CP001509.EA10        Location/Qualifiers
FT   CDS             complement(758657..759025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ea10"
FT                   /locus_tag="ECD_10017"
FT                   /product="Putative single-stranded DNA binding protein"
FT                   /note="similar to lambdap45"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42599"
FT                   /protein_id="ACT42599.1"
FT                   /translation="MSNIKKYIIDYDWKASIEIEIDHDVMTEEKLHQINNFWSDSEYRL
FT                   NKHGSVLNAVLIMLAQHALLIAISSDLNAYGVVCEFDWNDGNGQEGWPPMDGSEGIRIT
FT                   DIDTSGIFDSDDMTIKAA"
     MSNIKKYIID YDWKASIEIE IDHDVMTEEK LHQINNFWSD SEYRLNKHGS VLNAVLIMLA        60
     QHALLIAISS DLNAYGVVCE FDWNDGNGQE GWPPMDGSEG IRITDIDTSG IFDSDDMTIK       120
     AA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page