(data stored in ACNUC7421 zone)

EMBL: CP001509.EAEH

CP001509.EAEH        Location/Qualifiers
FT   CDS             284540..285772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="ECD_00256"
FT                   /product="attaching and effacing protein, pathogenesis
FT                   factor"
FT                   /note="similar to b0297"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42155"
FT                   /protein_id="ACT42155.1"
FT                   /translation="MSHYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDVEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRITLMAGVNPVGGSMWVDIEAPE
FT                   GVTEKDYQFLPSKADHFSGGKITRTFSTSKPGVYTFTFNALTYGGYEMTPVKVTINAVA
FT                   AETENGEEEMP"
     MSHYKTGHKQ PRFRYSVLAR CVAWANISVQ VLFPLAVTFT PVMAARAQHA VQPRLSMGNT        60
     TVTADNNVEK NVASFAANAG TFLSSQPDSD ATRNFITGMA TAKANQEIQE WLGKYGTARV       120
     KLNVDKDFSL KDSSLEMLYP IYDTPTNMLF TQGAIHRTDD RTQSNIGFGW RHFSGNDWMA       180
     GVNTFIDHDL SRSHTRIGVG AEYWRDYLKL SANGYIRASG WKKSPDVEDY QERPANGWDI       240
     RAEGYLPAWP QLGASLMYEQ YYGDEVGLFG KDKRQKDPHA ISAEVTYTPV PLLTLSAGHK       300
     QGKSGENDTR FGLEVNYRIT LMAGVNPVGG SMWVDIEAPE GVTEKDYQFL PSKADHFSGG       360
     KITRTFSTSK PGVYTFTFNA LTYGGYEMTP VKVTINAVAA ETENGEEEMP                  410
//

If you have problems or comments...

PBIL Back to PBIL home page