(data stored in ACNUC7421 zone)

EMBL: CP001509.ECPC

CP001509.ECPC        Location/Qualifiers
FT   CDS             complement(276992..279517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpC"
FT                   /locus_tag="ECD_00250"
FT                   /product="ECP production outer membrane protein"
FT                   /note="similar to b0291"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42149"
FT                   /protein_id="ACT42149.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGIYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGMLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQIWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSNIASISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGPFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYVNTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
     MPLRRFSPGL KAQFAFGMVF LFVQPDASAA DISAQQIGGV IIPQAFSQAL QDGMSVPLYI        60
     HLAGSQGRQD DQRIGSAFIW LDDGQLRIRK IQLEESEDNA SVSEQTRQQL MALANAPFNE       120
     ALTIPLTDNA QLDLSLRQLL LQLVVKREAL GTVLRSRSED IGQSSVNTLS SNLSYNFGIY       180
     NNQLRNGGSN TSSYLSLNNV TALREHHVVL DGSLYGIGSG QQDSELYKAM YERDFAGHRF       240
     AGGMLDTWNL QSLGPMTAIS AGKIYGLSWG NQASSTIFDS SQSATPVIAF LPAAGEVHLT       300
     RDGRLLSVQN FTMGNHEVDT RGLPYGIYDV EVEVIVNGRV ISKRTQRVNK LFSRGRGVGA       360
     PLAWQIWGGS FHMDRWSENG KKTRPAKESW LAGASTSGSL STLSWAATGY GYDNQAVGET       420
     RLTLPLGGAI NVNLQNMLAS DSSWSNIASI SATLPGGFSS LWVNQEKTRI GNQLRRSDAD       480
     NRAIGGTLNL NSLWSKLGTF SISYNDDRRY NSHYYTADYY QNVYSGPFGS LGLRAGIQRY       540
     NNGDSNANTG KYIALDLSLP LGNWFSAGMT HQNGYTMANL SARKQFDEGT IRTVGANLSR       600
     AISGDTGDDK TLSGGAYAQF DARYASGTLN VNSAADGYVN TNLTANGSVG WQGKNIAASG       660
     RTDGNAGVIF NTGLEDDGQI SAKINGRIFP LNGKRNYLPL SPYGRYEVEL QNSKNSLDSY       720
     DIVSGRKSHL TLYPGNVAVI EPEVKQMVTV SGRIRAEDGT LLANARINNH IGRTRTDENG       780
     EFVMDVDKKY PTIDFRYSGN KTCEVALELN QARGAVWVGD VVCSGLSSWA AVTQTGEENE       840
     S                                                                       841
//

If you have problems or comments...

PBIL Back to PBIL home page