(data stored in ACNUC7421 zone)

EMBL: CP001509.EMRE

CP001509.EMRE        Location/Qualifiers
FT   CDS             536910..537242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="ECD_00493"
FT                   /product="DLP12 prophage; multidrug resistance protein"
FT                   /note="similar to b0543"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42391"
FT                   /protein_id="ACT42391.1"
FT                   /translation="MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFW
FT                   LLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFGQRLDLPAIIGMMLICAGVLVINLL
FT                   SRSTPH"
     MNPYIYLGGA ILAEVIGTTL MKFSEGFTRL WPSVGTIICY CASFWLLAQT LAYIPTGIAY        60
     GIWSGVGIVL ISLLLWGFFG QRLDLPAIIG MMLICAGVLV INLLSRSTPH                  110
//

If you have problems or comments...

PBIL Back to PBIL home page