(data stored in ACNUC7421 zone)

EMBL: CP001509.ERPA

CP001509.ERPA        Location/Qualifiers
FT   CDS             179453..179797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="erpA"
FT                   /locus_tag="ECD_00155"
FT                   /product="iron-sulfur cluster insertion protein"
FT                   /note="similar to b0156"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42056"
FT                   /protein_id="ACT42056.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
     MSDDVALPLE FTDAAANKVK SLIADEDNPN LKLRVYITGG GCSGFQYGFT FDDQVNEGDM        60
     TIEKQGVGLV VDPMSLQYLV GGSVDYTEGL EGSRFIVTNP NAKSTCGCGS SFSI             114
//

If you have problems or comments...

PBIL Back to PBIL home page