(data stored in ACNUC7421 zone)

EMBL: CP001509.ESSD

CP001509.ESSD        Location/Qualifiers
FT   CDS             545572..545787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="essD"
FT                   /locus_tag="ECD_00506"
FT                   /product="DLP12 prophage; putative phage lysis protein"
FT                   /note="similar to b0554"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42403"
FT                   /protein_id="ACT42403.1"
FT                   /translation="MKSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSL
FT                   VFGLLTYLTNLYFKIKEDKRKAARGE"
     MKSMDKLTTG VAYGTSAGSA GYWFLQLLDK VTPSQWAAIG VLGSLVFGLL TYLTNLYFKI        60
     KEDKRKAARG E                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page