(data stored in ACNUC7421 zone)

EMBL: CP001509.FABZ

CP001509.FABZ        Location/Qualifiers
FT   CDS             204944..205399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECD_00178"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="similar to b0180"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42079"
FT                   /protein_id="ACT42079.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     MTTNTHTLQI EEILELLPHR FPFLLVDRVL DFEEGRFLRA VKNVSVNEPF FQGHFPGKPI        60
     FPGVLILEAM AQATGILAFK SVGKLEPGEL YYFAGIDEAR FKRPVVPGDQ MIMEVTFEKT       120
     RRGLTRFKGV ALVDGKVVCE ATMMCARSRE A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page