(data stored in ACNUC7421 zone)

EMBL: CP001509.FEPB

CP001509.FEPB        Location/Qualifiers
FT   CDS             complement(584041..584997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECD_00559"
FT                   /product="ferrienterobactin ABC transporter periplasmic
FT                   binding protein"
FT                   /note="similar to b0592"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42438"
FT                   /protein_id="ACT42438.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSATQVLERLKALF"
     MRLAPLYRNA LLLTGLLLSG IAAVQAADWP RQITDSRGTH TLESQPQRIV STSVTLTGSL        60
     LAIDAPVIAS GATTPNNRVA DDQGFLRQWS KVAKERKLQR LYIGEPSAEA VAAQMPDLIL       120
     ISATGGDSAL ALYDQLSTIA PTLIINYDDK SWQSLLTQLG EITGHEKQAA ERIAQFDKQL       180
     AAAKEQIKLP PQPVTAIVYT AAAHSANLWT PESAQGQMLE QLGFTLAKLP AGLNASQSQG       240
     KRHDIIQLGG ENLAAGLNGE SLFLFAGDQK DADAIYANPL LAHLPAVQNK QVYALGTETF       300
     RLDYYSATQV LERLKALF                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page